Transcript | Ll_transcript_264024 |
---|---|
CDS coordinates | 881-1672 (+) |
Peptide sequence | MVMKPIEDIVVTKPATTLERKPRPQKEQALNCPRCHSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGTLRNIPVGGLSKKNKRSSSNSSCSSTPPIKKVPDLLTPQNPKVHDGQDLNLSFRNINELVQQNSSNVSGSASSCTTTTTTNLSALELLTGITPGSMGVMSSFMSMHVPGDPNSVYTCGFPLQDFKSSLSFSLDGIGNFHGNNVQETSGRLLFPFEDLKQVASTNTTIIDHNNNEQQHEDSSNGGYSTGILGGGSW* |
ORF Type | complete |
Blastp | Dof zinc finger protein DOF4.6 from Arabidopsis with 42.31% of identity |
---|---|
Blastx | Dof zinc finger protein 1 from Oryza sativa with 43.08% of identity |
Eggnog | Zinc finger protein(ENOG410YH6N) |
Kegg | Link to kegg annotations (AT4G24060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019427056.1) |
Pfam | Dof domain, zinc finger (PF02701.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer