Transcript | Ll_transcript_264027 |
---|---|
CDS coordinates | 962-1735 (+) |
Peptide sequence | MVVKPIEDTTSLQRKPRTQKEQALINCPRCHSTNTKFCYYNNYSLTQPRYFCKACRRYWTEGGTLRNIPIGGGSRKNKRSSNSVSSSSNKKVSDLLTTQNPNVHDGHEHDLNLAFRINNTSVSASASSTITTNNTTTAASTSQLSVLELLNGITSGSRGLMSSFMPMHAPVLGDPNSVYTFPMQDFKQTLGFSLDGIGNLNGIIQETNGRLLFPFEDSKQVASTNNTTIMDHNNNKEQQHGDSNGGYWSGMLGGGSW* |
ORF Type | complete |
Blastp | Dof zinc finger protein DOF4.6 from Arabidopsis with 41.5% of identity |
---|---|
Blastx | Dof zinc finger protein DOF3.7 from Arabidopsis with 45.12% of identity |
Eggnog | Zinc finger protein(ENOG410YH6N) |
Kegg | Link to kegg annotations (AT4G24060) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451422.1) |
Pfam | Dof domain, zinc finger (PF02701.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer