Protein coding transcript 168828

• Transcript: Ll_transcript_264029
• CDS coordinates: 276-1076 (+)
• Peptide sequence: MDTAQWPQEMVVKPIEDTTSLQRKPRTQKEQALINCPRCHSTNTKFCYYNNYSLTQPRYFCKACRRYWTEGGTLRNIPIGGGSRKNKRSSNSVSSSSNKKVSDLLTTQNPNVHDGHEHDLNLAFRINNTSVSASASSTITTNNTTTAASTSQLSVLELLNGITSGSRGLMSSFMPMHAPVLGDPNSVYTFPMQDFKQTLGFSLDGIGNLNGIIQETNGRLLFPFEDSKQVASTNNTTIMDHNNNKEQQHGDSNGGYWSGMLGGGSW*
• ORF Type: complete

Annotations of Ll_transcript_264029

• Blastp: Dof zinc finger protein DOF4.6 from Arabidopsis with 40.63% of identity
• Blastx: Dof zinc finger protein DOF4.6 from Arabidopsis with 39.08% of identity
• Eggnog: Zinc finger protein(ENOG410YH6N)
• Kegg: Link to kegg annotations (AT4G24060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451422.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;