Protein coding transcript 168910

• Transcript: Ll_transcript_263613
• CDS coordinates: 1421-1798 (+)
• Peptide sequence: MTEINMISNIHHPNLVELIGCCVEGSHRILVYEFLENNSLANSLLGSRSKYIPLDWPKRAAICHGTASGLRFLHEEAQPNIVHRDIKASNILLDRNFNPKIGDFGLAKLFPDNVTHVSTRVAGTV*
• ORF Type: complete

Annotations of Ll_transcript_263613

• Blastp: Cold-responsive protein kinase 1 from Arabidopsis with 66.93% of identity
• Blastx: Cold-responsive protein kinase 1 from Arabidopsis with 62.3% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT1G16670)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462412.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;