Transcript | Ll_transcript_264649 |
---|---|
CDS coordinates | 1-453 (+) |
Peptide sequence | KDGKIRSLEQIYLHSLPIKEHQIIDTLVGPSLKDEVMKIMPVQKQTRAGQRTRFKAFVVVGDNNGHVGLGVKCSKEVATAIRGAIILAKLSVIPVRRGYWGNKIGKPHTVPCKVTGKCGSVTVRMVPAPRGSGIVAARVPKKVLQFAGIDD |
ORF Type | internal |
Blastp | 40S ribosomal protein S2-4 from Arabidopsis with 92.72% of identity |
---|---|
Blastx | 40S ribosomal protein S2-4 from Arabidopsis with 92.72% of identity |
Eggnog | Located at the back of the 30S subunit body where it stabilizes the conformation of the head with respect to the body (By similarity)(COG0098) |
Kegg | Link to kegg annotations (AT3G57490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424308.1) |
Pfam | Ribosomal protein S5, N-terminal domain (PF00333.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer