Transcript | Ll_transcript_263333 |
---|---|
CDS coordinates | 993-1715 (+) |
Peptide sequence | MPVNILGTFIIGSILGWILVKITSPPENIQGLVVGACSAGNLGNLPIIILPAICKDKGSPFGDPDVCHKYGMGYASLSMAIGSIFIWSYVYNIMRISSSKVHKEDRASSASINIQASGEILESLPDEFLEPQNSAKGDTDDAYTLLSSQESEDMEKVPISDKIKHNLRRILLNPNFKGIFAPSTLGAIVGFLIGLVPQIRTFMIGSDAPLHVLADSVSMLGDAAIPSITLIMGANLLKGLK |
ORF Type | 3prime_partial |
Blastp | Protein PIN-LIKES 3 from Arabidopsis with 48.35% of identity |
---|---|
Blastx | Protein PIN-LIKES 3 from Arabidopsis with 44.93% of identity |
Eggnog | Auxin Efflux Carrier(COG0679) |
Kegg | Link to kegg annotations (AT1G76520) |
CantataDB | Link to cantataDB annotations (CNT0000084) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019422514.1) |
Pfam | Membrane transport protein (PF03547.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer