Protein coding transcript 168987

• Transcript: Ll_transcript_263326
• CDS coordinates: 678-1622 (+)
• Peptide sequence: MGLQELFYVASMPVIKILIVTAIGLFLALDNINLLGKDARIQVNHLVHYVFNPALVGSNLADTITFENFVVLWFMPVNILGTFIIGSILGWILVKITSPPENIQGLVVGACSAGNLGNLPIIILPAICKDKGSPFGDPDVCHKYGMGYASLSMAIGSIFIWSYVYNIMRISSSKVHKEDRASSASINIQASGEILESLPDEFLEPQNSAKGDTDDAYTLLSSQESEDMEKVPISDKIKHNLRRILLNPNFKGIFAPSTLGAIVGFLIGLVPQIRTFMIGSDAPLHVLADSVSMLGDAAIPSITLIMGANLLKGLK
• ORF Type: 3prime_partial

Annotations of Ll_transcript_263326

• Blastp: Protein PIN-LIKES 3 from Arabidopsis with 49.36% of identity
• Blastx: Protein PIN-LIKES 3 from Arabidopsis with 49.36% of identity
• Eggnog: Auxin Efflux Carrier(COG0679)
• Kegg: Link to kegg annotations (AT1G76520)
• CantataDB: Link to cantataDB annotations (CNT0000084)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422514.1)
• Pfam: Membrane transport protein (PF03547.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;