Protein coding transcript 168995

• Transcript: Ll_transcript_263350
• CDS coordinates: 2-355 (+)
• Peptide sequence: AKRKRNLPGNPDPDSEVIALSPKTLMATNRFICEICNKGFQRDQNLQLHRRGHNLPWKLKQRTNKEVIRKKVYVCPEESCVHHDPSRALGDLTGIKKHFCRKHGEKKWKCEKCSKKYA
• ORF Type: internal

Annotations of Ll_transcript_263350

• Blastp: Protein indeterminate-domain 11 from Arabidopsis with 93.16% of identity
• Blastx: Protein indeterminate-domain 11 from Arabidopsis with 93.2% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AT3G13810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435341.1)
• Pfam: C2H2-type zinc finger (PF13912.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;