| Transcript | Ll_transcript_297619 |
|---|---|
| CDS coordinates | 3-302 (+) |
| Peptide sequence | RLCHTPTLRSTSSLLRQLSFLKHPTFSPPTRPFTTTTTRTMSSATSFYDFKPKDDKGAPFPLANMKGKVVLVVNTASKCGFTPQLDDLEALYKDIKTAHP |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Glutathione peroxidase-like peroxiredoxin gpx1 from Schizosaccharomyces with 71.43% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (SPBC32F12.03c) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019444505.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer