Transcript | Ll_transcript_263016 |
---|---|
CDS coordinates | 2740-3318 (+) |
Peptide sequence | MLSTRILEAIVHLKEPNGSDKVAIASYIEDNYQSQSKLRDILPAKLKHMVATGKIIKEKHKYRLAPSSRTNEKRRISSASNLDGRAKDFPEAEKYDDNICSKPKDSLGAGKSDDKIIRSKSQNDGEPSKAKGMRVREVAAKAAKAVAEAEAATAEAERAARFADELEAEAEASEVIHQAILKAFQSKTFRLW* |
ORF Type | complete |
Blastp | Single myb histone 1 from Zea with 46.84% of identity |
---|---|
Blastx | Single myb histone 1 from Zea with 44.09% of identity |
Eggnog | single myb histone(ENOG4111SQS) |
Kegg | Link to kegg annotations (100274000) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434703.1) |
Pfam | linker histone H1 and H5 family (PF00538.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer