Protein coding transcript 169004

• Transcript: Ll_transcript_263020
• CDS coordinates: 2740-3318 (+)
• Peptide sequence: MLSTRILEAIVHLKEPNGSDKVAIASYIEDNYQSQSKLRDILPAKLKHMVATGKIIKEKHKYRLAPSSRTNEKRRISSASNLDGRAKDFPEAEKYDDNICSKPKDSLGAGKSDDKIIRSKSQNDGEPSKAKGMRVREVAAKAAKAVAEAEAATAEAERAARFADELEAEAEASEVIHQAILKAFQSKTFRLW*
• ORF Type: complete

Annotations of Ll_transcript_263020

• Blastp: Single myb histone 1 from Zea with 46.84% of identity
• Blastx: Single myb histone 1 from Zea with 44.09% of identity
• Eggnog: single myb histone(ENOG4111SQS)
• Kegg: Link to kegg annotations (100274000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434703.1)
• Pfam: linker histone H1 and H5 family (PF00538.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;