Transcript | Ll_transcript_263025 |
---|---|
CDS coordinates | 3606-4157 (+) |
Peptide sequence | MIESAYKISADDKMKSRSARPAGDQDNKTTVRTKPDSKTDTKVSDSEVGMPEEMSFSQKDINVKQSKSQTTNNVNPNIDTNNIVSSSLTSTDDGGLPTIMSTKQQGEKKPASQSHASNRPVLEENIVLGVALDGSKRTLPIDEGIDNAATTREAKEMAACQGGNGSPKGTDGNDKIAIAPTSK* |
ORF Type | complete |
Blastp | Mechanosensitive ion channel protein 2, chloroplastic from Arabidopsis with 38.76% of identity |
---|---|
Blastx | Mechanosensitive ion channel protein 2, chloroplastic from Arabidopsis with 90.76% of identity |
Eggnog | Mechanosensitive ion channel(COG0668) |
Kegg | Link to kegg annotations (AT5G10490) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421403.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer