Protein coding transcript 16908

• Transcript: Ll_transcript_276616
• CDS coordinates: 301-1047 (+)
• Peptide sequence: MGSFWIWWIIALIHILPFFDSKPLIQTIQGRTPQSPVECNQSGCTLQNSYGAWGDRKDCYALNITYPTTEEQLRLAVSHAVQNNLKVKVVTKFSHTIPKLACPEGKTNTLLISTEKYDSGIQIDAANLAVTADSGVGLRALIDAVESAGFSLVAAPYWEGVSVGGLISTGAHGSSWWGKGGAVHDHVLGLRIIVPASEYEGYAKILWLEAPDPLFNAAKVSLGVLGAISKVSILIFLCRPILYVSFVF*
• ORF Type: complete

Annotations of Ll_transcript_276616

• Blastp: L-gulonolactone oxidase 3 from Arabidopsis with 62.33% of identity
• Blastx: L-gulonolactone oxidase 3 from Arabidopsis with 62.33% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT5G11540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429823.1)
• Pfam: FAD binding domain (PF01565.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;