Protein coding transcript 16910

• Transcript: Ll_transcript_276622
• CDS coordinates: 301-1281 (+)
• Peptide sequence: MGSFWIWWIIALIHILPFFDSKPLIQTIQGRTPQSPVECNQSGCTLQNSYGAWGDRKDCYALNITYPTTEEQLRLAVSHAVQNNLKVKVVTKFSHTIPKLACPEGKTNTLLISTEKYDSGIQIDAANLAVTADSGVGLRALIDAVESAGFSLVAAPYWEGVSVGGLISTGAHGSSWWGKGGAVHDHVLGLRIIVPASEYEGYAKILWLEAPDPLFNAAKVSLGVLGAISKVKLSLEHRFKRSITYNFTDDAYIEDVYINHAKQYEFADITWYPSKHTAVYRYDSRVSLDASGDGVYDFIGFQANSILISESVRAAGNDLFNCTSKF*
• ORF Type: complete

Annotations of Ll_transcript_276622

• Blastp: L-gulonolactone oxidase 3 from Arabidopsis with 63.25% of identity
• Blastx: L-gulonolactone oxidase 3 from Arabidopsis with 67.67% of identity
• Eggnog: FAD linked oxidase domain protein(COG0277)
• Kegg: Link to kegg annotations (AT5G11540)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429823.1)
• Pfam: FAD binding domain (PF01565.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;