Protein coding transcript 169157

• Transcript: Ll_transcript_264414
• CDS coordinates: 49-576 (+)
• Peptide sequence: MEAAGEETKRGKAVKLDSVVVVTSSEKKMLTDITNHLKSPSNQQLKQHSASNTAISDVSTNRLLKENAMLMQLLANRNAIIESCKSELQKSQTDFQKLQKQNSELALTNSRMLAELNLSRQRFRELQHELGSKNGILKAMKLEAKEHNQKMKHESHTNQVLSQFSHISYFRSLIS*
• ORF Type: complete

Annotations of Ll_transcript_264414

• Blastp: SHUGOSHIN 1 from Arabidopsis with 36.65% of identity
• Blastx: SHUGOSHIN 1 from Arabidopsis with 36.65% of identity
• Eggnog: Shugoshin C terminus(ENOG411043H)
• Kegg: Link to kegg annotations (AT3G10440)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019441063.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;