Transcript | Ll_transcript_264414 |
---|---|
CDS coordinates | 49-576 (+) |
Peptide sequence | MEAAGEETKRGKAVKLDSVVVVTSSEKKMLTDITNHLKSPSNQQLKQHSASNTAISDVSTNRLLKENAMLMQLLANRNAIIESCKSELQKSQTDFQKLQKQNSELALTNSRMLAELNLSRQRFRELQHELGSKNGILKAMKLEAKEHNQKMKHESHTNQVLSQFSHISYFRSLIS* |
ORF Type | complete |
Blastp | SHUGOSHIN 1 from Arabidopsis with 36.65% of identity |
---|---|
Blastx | SHUGOSHIN 1 from Arabidopsis with 36.65% of identity |
Eggnog | Shugoshin C terminus(ENOG411043H) |
Kegg | Link to kegg annotations (AT3G10440) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441063.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer