| Transcript | Ll_transcript_264403 |
|---|---|
| CDS coordinates | 49-516 (+) |
| Peptide sequence | MEAAGEETKRGKAVKLDSVVVVTSSEKKMLTDITNHLKSPSNQQLKQHSASNTAISDVSTNRLLKENAMLMQLLANRNAIIESCKSELQKSQTDFQKLQKQNSELALTNSRMLAELNLSRQRFRELQHELGSKNGILKAMKLEVKVGLTISMLIN* |
| ORF Type | complete |
| Blastp | SHUGOSHIN 2 from Arabidopsis with 48.75% of identity |
|---|---|
| Blastx | SHUGOSHIN 1 from Arabidopsis with 37.86% of identity |
| Eggnog | NA(ENOG410YNQ1) |
| Kegg | Link to kegg annotations (AT5G04320) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019441063.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer