Protein coding transcript 169195

• Transcript: Ll_transcript_262382
• CDS coordinates: 441-1406 (+)
• Peptide sequence: MTKSPKEADFALKEEGLISSDHEKSKASASSQWLRLKDPRIVRVSRAFGGKDRHSKVCTIRGLRDRRVRLSVPTAIYLYDLQHRLGLNQPSKVFDWLLNAAKHEIDELPPLPIPPGNFTLGYPSLATSNEVTTSRNNTRQLLNAPDSDLIDIREDHEQESGYCVDVHVLPNNLLLPRANHPSFLGLLNTMPLGGYQWEPSTDVAQLGNHGFVNQTDNIQSINVVPFPSTLSLSNENSSSQILVCPQGATTQSYFPASHVPAMEKDYRQINHFQMLNPSSHQNHMMNNSLNPSQHLRMTPKHFHSSNSSESQSHKDQDFPSK*
• ORF Type: complete

Annotations of Ll_transcript_262382

• Blastp: Transcription factor TCP13 from Arabidopsis with 43.36% of identity
• Blastx: Transcription factor TCP13 from Arabidopsis with 84.29% of identity
• Eggnog: Transcription factor(ENOG410YQU0)
• Kegg: Link to kegg annotations (AT3G02150)
• CantataDB: Link to cantataDB annotations (CNT0000744)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452971.1)
• Pfam: TCP family transcription factor (PF03634.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;