Transcript | Ll_transcript_277168 |
---|---|
CDS coordinates | 264-584 (+) |
Peptide sequence | MSQSLIAVPLTQQLFKRNNGVLSFFASSHSTSSIFRSHSLSLFSQNQKRRNPLSPIKPPSVSFSSSQTTMGGDTPQNDAGMDAVQRRLMFDDESVPFPFSFPVILF* |
ORF Type | complete |
Blastp | Isopentenyl-diphosphate Delta-isomerase I from Clarkia with 61.11% of identity |
---|---|
Blastx | Isopentenyl-diphosphate Delta-isomerase I from Camptotheca with 96.67% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019431222.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer