| Transcript | Ll_transcript_277171 |
|---|---|
| CDS coordinates | 264-725 (+) |
| Peptide sequence | MSQSLIAVPLTQQLFKRNNGVLSFFASSHSTSSIFRSHSLSLFSQNQKRRNPLSPIKPPSVSFSSSQTTMGGDTPQNDAGMDAVQRRLMFDDECILVDETDRVVGHDSKYNCHLMEKIDSENLLHRAFSVFLFNSKYELLLQQRSATKVTFPLV |
| ORF Type | 3prime_partial |
| Blastp | Isopentenyl-diphosphate Delta-isomerase I from Clarkia with 84.04% of identity |
|---|---|
| Blastx | Isopentenyl-diphosphate Delta-isomerase I from Clarkia with 84.04% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019431222.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer