Protein coding transcript 16924

• Transcript: Ll_transcript_277174
• CDS coordinates: 2500-3315 (+)
• Peptide sequence: MRRGFSFSMYNFLGLYTNISMSSFSLYILNILTSIFTNASLISSSYLNWYFFVLEFHRCILVDETDRVVGHDSKYNCHLMEKIDSENLLHRAFSVFLFNSKYELLLQQRSATKVTFPLVWTNTCCSHPLYRESELIDENSLGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRILYKAPSDGKWGEHELDYLLFTVRDVNLHPNPDEVADVKYVTRDQLKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHLEQGTLGEVIDMKTIHKLT*
• ORF Type: complete

Annotations of Ll_transcript_277174

• Blastp: Isopentenyl-diphosphate Delta-isomerase I from Camptotheca with 90.61% of identity
• Blastx: Isopentenyl-diphosphate Delta-isomerase I from Camptotheca with 90.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431222.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;