Protein coding transcript 169270

• Transcript: Ll_transcript_262330
• CDS coordinates: 3-428 (+)
• Peptide sequence: MEDNQTNSSSEDVKDNSKEGLKCAPEKTASNVCCSCSKSSSCKTTKCQCRALGNNCGSSCGCLATKCANRASVSNESQELTQSGVEGTGNDSRIVETDKNQILATQGAELLQGALVDRTAETNKAHRPRRPLSDIGNTAVR*
• ORF Type: complete

Annotations of Ll_transcript_262330

• Blastp: Kinesin-like protein KIN-4C from Arabidopsis with 46.53% of identity
• Blastx: Kinesin-like protein KIN-4C from Arabidopsis with 30.97% of identity
• Eggnog: Kinesin family member(COG5059)
• Kegg: Link to kegg annotations (AT5G60930)
• CantataDB: Link to cantataDB annotations (CNT0002543)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456477.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;