Protein coding transcript 169298

• Transcript: Ll_transcript_263886
• CDS coordinates: 167-1003 (+)
• Peptide sequence: MGRIPCCPKEIVKGAWSTEEDEILSQFVTTHGEGKWHKLALKAGLKRCGKSCRQRWLNYLKPGIKRGEISLDEEDMIIRLHRLLGNRWTLIAKRLPGRTDNEIKNYWNTNLSKKLKKQPTLSSWPLSPSLEHNHKCEQVEKTRQTHVALEAHLPRRVKDVQYNKTLQNQGYSSPSCSNEREGSRNSDEATNTLNDYLIDIDQNKEFIEDDFSSKVLEIEDQKRVGLTKSPTSTTLSNQYHILTSKFDPLETFLDVELERMASFMGHNEENYCNRGPPS*
• ORF Type: complete

Annotations of Ll_transcript_263886

• Blastp: Anthocyanin regulatory C1 protein from Zea with 71.43% of identity
• Blastx: Anthocyanin regulatory C1 protein from Zea with 71.43% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (541757)
• CantataDB: Link to cantataDB annotations (CNT0000269)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425531.1)
• Pfam: Myb-like DNA-binding domain (PF00249.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;