| Transcript | Ll_transcript_297579 |
|---|---|
| CDS coordinates | 2-382 (+) |
| Peptide sequence | LIILGFAFAAVRASVVPITVDEKVADADFLQKQKKVLDLYKGVAYGSTSNTENSEFAFPADQFTEPDVSKRFLETYKHGFLPKNGVFTLSCHHTRYETIRLFDVLFFAKDFETFYKVASWAKKNVNP |
| ORF Type | internal |
| Blastp | - |
|---|---|
| Blastx | Sex-specific storage-protein 2 from Bombyx with 34.85% of identity |
| Eggnog | Larval storage protein (LSP) which may serve as a store of amino acids for synthesis of adult proteins(ENOG410XR2D) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_020981715.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer