Protein coding transcript 169330

• Transcript: Ll_transcript_264774
• CDS coordinates: 798-1223 (+)
• Peptide sequence: MALRKILRHSSSIANLYFPSTPLSLSFSNRFSSSSSSSSETLNSETPTSSISIDRSSLYNPPDHSHLPNSDSELSKHLKGIIKFRGGPVSVGEYMSQVLTNPKSGYYINRDVFGAQGDFITSPEVSQMFGEVNSLIYSSFH*
• ORF Type: complete

Annotations of Ll_transcript_264774

• Blastp: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial from Sophophora with 54.17% of identity
• Blastx: GDSL esterase/lipase LTL1 from Arabidopsis with 78.79% of identity
• Eggnog: NADH dehydrogenase ubiquinone complex I, assembly factor 7(COG1565)
• Kegg: Link to kegg annotations (Dmel_CG17726)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454282.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;