Protein coding transcript 169335

• Transcript: Ll_transcript_264745
• CDS coordinates: 836-1420 (+)
• Peptide sequence: MALRKILRHSSSIANLYFPSTPLSLSFSNRFSSSSSSSSETLNSETPTSSISIDRSSLYNPPDHSHLPNSDSELSKHLKGIIKFRGGPVSVGEYMSQVLTNPKSGYYINRDVFGAQGDFITSPEVSQMFGEMVGVWVMCLWEQMGQPQRLNLVEMGPGRGTLMADLLRVLNYDADMSLYWNLHLNVSAICCVVD*
• ORF Type: complete

Annotations of Ll_transcript_264745

• Blastp: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial from Dictyostelium with 54.1% of identity
• Blastx: Protein arginine methyltransferase NDUFAF7 homolog, mitochondrial from Dictyostelium with 54.1% of identity
• Eggnog: NADH dehydrogenase ubiquinone complex I, assembly factor 7(COG1565)
• Kegg: Link to kegg annotations (DDB_G0282615)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454282.1)
• Pfam: Putative S-adenosyl-L-methionine-dependent methyltransferase (PF02636.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;