Protein coding transcript 169374

• Transcript: Ll_transcript_264472
• CDS coordinates: 232-1590 (+)
• Peptide sequence: MEEINCHNLFGKYEMGRLLGKGTFAKVYYAKQIATGESVAVKVINKDQVKKQGMMEQITREISVMRLVRHPNVVELKEVLATKKKIYFVMEYVRGGELFAKVAKGKLKEDQARKYFQQLISAIDFCHSRGVSHRDLKPENLLLDHSENLKISDFGLSALPEQLRFDGLLHTQCGTPAYVAPEVLRKKGYDGSKADIWSCGIILYVLLAGFLPFQHENLMSMYSMVLRAQFQFPPWFSSDSRKLISNILVADPSKRTTIPAIMRVPWFRKGFEFPVTKVEAEEEEEGLVKEAEGSRKSHKVSSPKFFNAFEFISSMSSGFDLSGLFESKKKKGSVFTSKCSATAIVDKIETAAEGLSFKVTGVKDFTIRMQGPPEGRKGRLFVTAEVFEVAPEVAVVEFSKSAGDTLEYAKFYEEDMRPALKDIVWSWQGDATCNPNITGSQGEESQNQVLTN*
• ORF Type: complete

Annotations of Ll_transcript_264472

• Blastp: CBL-interacting serine/threonine-protein kinase 25 from Arabidopsis with 69.02% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 5 from Arabidopsis with 69.7% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G25110)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019417278.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;