Protein coding transcript 169378

• Transcript: Ll_transcript_264479
• CDS coordinates: 96-863 (+)
• Peptide sequence: MKGLLSNVINPISIGVNGRTNHLHYPQSLQPSSKSLQFHLGMNHSRPLHITASIRASTQHFHNTAPSKENIELWRNVDAVCFDVDSTVCIDEGIDELALYCGAGNAVAQLTASAMGGSVPFEEALAARLSLFNPSLSQLQSFLHQHPPRLNPGIEDLVQKLKAKNTDVYLISGGFRQMINPVASILGIPKENIFANQLLFGSSGEFVGFDKNEPTSRSGGKATAVQQIRKVSFAHSCCLFLLSALLVKLINYFSGP
• ORF Type: 3prime_partial

Annotations of Ll_transcript_264479

• Blastp: Phosphoserine phosphatase, chloroplastic from Arabidopsis with 72.68% of identity
• Blastx: Phosphoserine phosphatase, chloroplastic from Arabidopsis with 72.68% of identity
• Eggnog: phosphoserine phosphatase activity(COG0560)
• Kegg: Link to kegg annotations (AT1G18640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451719.1)
• Pfam: haloacid dehalogenase-like hydrolase (PF00702.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;