Protein coding transcript 169379

• Transcript: Ll_transcript_264486
• CDS coordinates: 96-557 (+)
• Peptide sequence: MKGLLSNVINPISIGVNGRTNHLHYPQSLQPSSKSLQFHLGMNHSRPLHITASIRASTQHFHNTAPSKENIELWRNVDAVCFDVDSTVCIDEGIDELALYCGAGNAVAQLTASAMGGSVPFEEALAARLSLFNPSLSQLQSFLHQHPPRSNFD*
• ORF Type: complete

Annotations of Ll_transcript_264486

• Blastp: Phosphoserine phosphatase, chloroplastic from Arabidopsis with 63.72% of identity
• Blastx: Phosphoserine phosphatase, chloroplastic from Arabidopsis with 82.86% of identity
• Eggnog: phosphoserine phosphatase activity(COG0560)
• Kegg: Link to kegg annotations (AT1G18640)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004499855.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;