Protein coding transcript 169411

• Transcript: Ll_transcript_264519
• CDS coordinates: 3-935 (+)
• Peptide sequence: VGFCHARGVFHRDIKPENLLLDENGELKVSDFGLSAVSDQIRQDGLFHTFCGTPAYVAPEVLGRKGYDGAKVDIWACGVVLFVLMAGYLPFQDQNVVAMYRKIYKGSFRCPRWFTPEITKLLSRLLDTNPQTRISIPEIMEYKWFKKGFKPIKFYVEDDIVRSLDDEVNMSDDDGAVSESDFEIVTRRRHNNVSLPRPASLNAFDIISFSSGFNLSGLFEEKGDEARFVSGAPVSKILSKLEEVARLVSFTVRKKDCRVSLEGSREGVKGPLTIAAEIFELTPSLVVVEVKKKGGDSEEYERFCNIELKPA
• ORF Type: internal

Annotations of Ll_transcript_264519

• Blastp: CBL-interacting serine/threonine-protein kinase 12 from Arabidopsis with 76.9% of identity
• Blastx: CBL-interacting serine/threonine-protein kinase 12 from Arabidopsis with 76.9% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G18700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444851.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;