Protein coding transcript 169455

• Transcript: Ll_transcript_264158
• CDS coordinates: 105-551 (+)
• Peptide sequence: MFRRILSHSSSSACRIHNASLSSSETRSLTTALSETRSYTRRAAANLALPCFPPTLTGGFRENQLSTSIARFMSSNASNKQGKATDKTKKDITNVEEDPFNAPTYNIPEKPVTFVEGASYSVIILAGLGVAAAAGYAVFKELIFQPKE*
• ORF Type: complete

Annotations of Ll_transcript_264158

• Blastp: Probable mitochondrial import inner membrane translocase subunit TIM21 from Arabidopsis with 65.06% of identity
• Blastx: Probable mitochondrial import inner membrane translocase subunit TIM21 from Arabidopsis with 78.02% of identity
• Eggnog: Import inner membrane translocase, subunit(ENOG4111I5D)
• Kegg: Link to kegg annotations (AT4G00026)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429018.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;