Protein coding transcript 16946

• Transcript: Ll_transcript_276259
• CDS coordinates: 777-1271 (+)
• Peptide sequence: MDNSNSRNNDSLGVNKMGKNIRKSPLHQPNFGNNAAKQQPQPQVYNISKNDFRDIVQQLTGSPSHHSQDHPPRPPNNPHKPQSMRLQKIRPPPLTPINRPCLPSQMPVYTAPPPIPYNNAMPRPPAQFGQPSPTPLQPLTPGDLWANTTESPISAYMRYLQNSMN
• ORF Type: 3prime_partial

Annotations of Ll_transcript_276259

• Blastp: Protein HAIKU1 from Arabidopsis with 52.98% of identity
• Blastx: Protein HAIKU1 from Arabidopsis with 51.81% of identity
• Eggnog: VQ motif(ENOG410YRKU)
• Kegg: Link to kegg annotations (AT2G35230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421886.1)
• Pfam: VQ motif (PF05678.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;