Protein coding transcript 169462

• Transcript: Ll_transcript_264148
• CDS coordinates: 105-629 (+)
• Peptide sequence: MFRRILSHSSSSACRIHNASLSSSETRSLTTALSETRSYTRRAAANLALPCFPPTLTGGFRENQLSTSIARFMSSNASNKQGKATDKTKKDITNVEEDPFNAPTYNIPEKPVTFVEGASYSVIILAGLGVAAAAGYAVFKELIFQPKEYKIYNKALKRIQDDGQVSELLLSYPT*
• ORF Type: complete

Annotations of Ll_transcript_264148

• Blastp: Probable mitochondrial import inner membrane translocase subunit TIM21 from Arabidopsis with 68% of identity
• Blastx: Probable mitochondrial import inner membrane translocase subunit TIM21 from Arabidopsis with 77.17% of identity
• Eggnog: Import inner membrane translocase, subunit(ENOG4111I5D)
• Kegg: Link to kegg annotations (AT4G00026)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453271.1)
• Pfam: TIM21 (PF08294.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;