Transcript | Ll_transcript_297647 |
---|---|
CDS coordinates | 3-344 (+) |
Peptide sequence | GNEPMYSGITGQELGADIYVGVVYYQRLRHMVNDKYQVRTTGPVTPLTGQPIKGRAKGGGIRVGEMERDALLAHGTAFLLQDRLLNCSDYTKAWLCKGCGSFLSTQPAVGQFGR |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | DNA-directed RNA polymerase I subunit RPA2 from Neurospora with 84.82% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (NCU08616) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003609884.2) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer