Transcript | Ll_transcript_262743 |
---|---|
CDS coordinates | 2-652 (+) |
Peptide sequence | WIALVQLLLYLLRSHLPFLTCPLSSVKVIALLKERLGVKIDKKLPMVDYRKYSRVRKWTVGISGGKDLIAIIRASGSISRVESQLSVSSSGIIAEKLIEKIRSVRESKKYKAAIIRIDSPGGDALASDLMWREIRLLAASKPVIASMSDVAASGGYYMAMAAEAIVAESLTLTGSIGVVTGKFNLGKLYEKIGFNKETISRGRYAELFAAEQRPFR* |
ORF Type | 5prime_partial |
Blastp | Serine protease SPPA, chloroplastic from Arabidopsis with 80% of identity |
---|---|
Blastx | Serine protease SPPA, chloroplastic from Arabidopsis with 80.85% of identity |
Eggnog | Signal peptide peptidase, SppA(COG0616) |
Kegg | Link to kegg annotations (AT1G73990) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019437141.1) |
Pfam | Peptidase family S49 (PF01343.17) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer