Protein coding transcript 169610

• Transcript: Ll_transcript_262691
• CDS coordinates: 70-714 (+)
• Peptide sequence: MYKLVGEERFLLWAVCSIQLQVLCGNGGNKLLLLAEGLLKKQVASHSLHEPEALMVYISVLERQAKFGDALELLSGKLGSLFMTEVDKLRIQGRLLAQADDYAAATDIFHKILESCPDDWECFLHYLGCLLEDGSIWSDEAVNDPVHPPKSINCKVSHLTDEQFNSRISIASDFIQKLQADTTNNMIRCPYLATIEIERRKHLRGKGNDDNYRN*
• ORF Type: complete

Annotations of Ll_transcript_262691

• Blastp: N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 71.9% of identity
• Blastx: N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 74.25% of identity
• Eggnog: N-alpha-acetyltransferase 25, NatB auxiliary subunit(ENOG410XRXD)
• Kegg: Link to kegg annotations (AT5G58450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435515.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;