Protein coding transcript 169612

• Transcript: Ll_transcript_262693
• CDS coordinates: 2775-3302 (+)
• Peptide sequence: MIRCPYLATIEIERRKHLRGKGNDDNLMDSIVQYFCRFGHLACFTPDVEMFVEVFTPDKKTELLGKLMKSSEALSTPPIKTVGLSISLFKLQQLLLGGMFKSSIGDLELSCAQMSEMYCKNLPLSKDLDPQEGMHGEELLSVTCNVLVQLFWRTKNVGYLVEAIMVLEFGLAIRR*
• ORF Type: complete

Annotations of Ll_transcript_262693

• Blastp: N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 51.45% of identity
• Blastx: N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 82.7% of identity
• Eggnog: N-alpha-acetyltransferase 25, NatB auxiliary subunit(ENOG410XRXD)
• Kegg: Link to kegg annotations (AT5G58450)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019435515.1)
• Pfam: N-acetyltransferase B complex (NatB) non catalytic subunit (PF09797.8)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;