Transcript | Ll_transcript_262693 |
---|---|
CDS coordinates | 2775-3302 (+) |
Peptide sequence | MIRCPYLATIEIERRKHLRGKGNDDNLMDSIVQYFCRFGHLACFTPDVEMFVEVFTPDKKTELLGKLMKSSEALSTPPIKTVGLSISLFKLQQLLLGGMFKSSIGDLELSCAQMSEMYCKNLPLSKDLDPQEGMHGEELLSVTCNVLVQLFWRTKNVGYLVEAIMVLEFGLAIRR* |
ORF Type | complete |
Blastp | N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 51.45% of identity |
---|---|
Blastx | N-terminal acetyltransferase B complex auxiliary subunit NAA25 from Arabidopsis with 82.7% of identity |
Eggnog | N-alpha-acetyltransferase 25, NatB auxiliary subunit(ENOG410XRXD) |
Kegg | Link to kegg annotations (AT5G58450) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019435515.1) |
Pfam | N-acetyltransferase B complex (NatB) non catalytic subunit (PF09797.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer