Protein coding transcript 169643

• Transcript: Ll_transcript_263828
• CDS coordinates: 3337-4050 (+)
• Peptide sequence: MSYEEYRRWIIQTFPNVSKGPTLDLVAGSFSGGTAVLFTYPLDLIRTKLAYQIVSPTKLNASGMVHNEQVYKGILDCFGKTYKEGGFRSLYRGVAPTLVGIFPYAGLKFYFYEEMKLHVPEEYKKSIMVKLTCGSVAGLLGQTFTYPLEVVRRQMQVQKLMGSDNLELRGTVKSLVLIAQKQGWKQLFSGLSINYIKVVPSVAIGFTVYDTMKSYLRVPSRDEEAADEAVTNKRIRQ*
• ORF Type: complete

Annotations of Ll_transcript_263828

• Blastp: Mitochondrial carrier protein CoAc2 from Arabidopsis with 67.23% of identity
• Blastx: Mitochondrial carrier protein CoAc2 from Arabidopsis with 68.63% of identity
• Eggnog: Solute carrier family 25(ENOG410ZRF1)
• Kegg: Link to kegg annotations (AT4G26180)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436200.1)
• Pfam: Mitochondrial carrier protein (PF00153.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;