Transcript | Ll_transcript_263835 |
---|---|
CDS coordinates | 30-1043 (+) |
Peptide sequence | MRKKREEEEGEEGIKNDVLQKMPLFCKELVAGGLAGAFAKSVVAPLERLKILFQTRSGEFHTTGFVGSANRIAKTEGILGFYRGNGASVARIIPYAAIHYMSYEEYRRWIIQTFPNVSKGPTLDLVAGSFSGGTAVLFTYPLDLIRTKLAYQIVSPTKLNASGMVHNEQVYKGILDCFGKTYKEGGFRSLYRGVAPTLVGIFPYAGLKFYFYEEMKLHVPEEYKKSIMVKLTCGSVAGLLGQTFTYPLEVVRRQMQVQKLMGSDNLELRGTVKSLVLIAQKQGWKQLFSGLSINYIKVVPSVAIGFTVYDTMKSYLRVPSRDEEAADEAVTNKRIRQ* |
ORF Type | complete |
Blastp | Mitochondrial carrier protein CoAc2 from Arabidopsis with 67.28% of identity |
---|---|
Blastx | Mitochondrial carrier protein CoAc2 from Arabidopsis with 67.29% of identity |
Eggnog | Solute carrier family 25(ENOG410ZRF1) |
Kegg | Link to kegg annotations (AT4G26180) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436200.1) |
Pfam | Mitochondrial carrier protein (PF00153.26) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer