Protein coding transcript 169680

• Transcript: Ll_transcript_263570
• CDS coordinates: 43-867 (+)
• Peptide sequence: MSFYVISRRLSPRSTSPIALSLRFASSSRSYSSSFREERDTFGPIQVPSDKLWGAQTQRSLQNFDIGGARERMPEPIIRAFGILKKCAAKVNIEYGLDPTVGKAVMQAAQEVAEGKLNDHFPLVVWQTGSGTQSNMNANEVIANRAAEILGHKRGEKIVHPNDHVNRSQSSNDTFPTVMHIAAAVEVNSSLIPKLKTLHSTLNAKSVEFKDIVKIGRTHTQDATPLTLGQEFSGYTTQVRYGIDRVIGTLPRMYQVRHLANINLMFFFHLLLEF*
• ORF Type: complete

Annotations of Ll_transcript_263570

• Blastp: Fumarate hydratase 1, mitochondrial from Arabidopsis with 84.38% of identity
• Blastx: Fumarate hydratase 1, mitochondrial from Arabidopsis with 84.38% of identity
• Eggnog: fumarate hydratase class II(COG0114)
• Kegg: Link to kegg annotations (AT2G47510)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453104.1)
• Pfam: Lyase (PF00206.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;