Protein coding transcript 1697

• Transcript: Ll_transcript_297612
• CDS coordinates: 2-298 (+)
• Peptide sequence: WFSEQLASGTTKNINTMAVFLTLAYLYEKTGEQTYLPWLDSWAEWAMYGLPRTPFDGMQHMTYLTDNHNELWDDTLMMTVLPLAKIGKLLNRPHYIEEV
• ORF Type: internal

Annotations of Ll_transcript_297612

• Blastp: Unsaturated rhamnogalacturonyl hydrolase YesR from Bacillus with 31.68% of identity
• Blastx: Unsaturated rhamnogalacturonyl hydrolase YesR from Bacillus with 31.68% of identity
• Eggnog: Glycosyl Hydrolase Family 88(COG4225)
• Kegg: Link to kegg annotations (BSU07000)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438958.1)
• Pfam: Glycosyl Hydrolase Family 88 (PF07470.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;