Protein coding transcript 169733

• Transcript: Ll_transcript_263303
• CDS coordinates: 173-730 (+)
• Peptide sequence: MEKNCKVCVTGSTGYIGSYLVKKLLDKGYTVHATLRDLSTLFLTLSAISLLENESKVRLLKGLPHSEGKLLLFEADIYNPIDFEPAIQGCQFVFHVATPLAHEAGSQYKDSSEASLAGIKSIMMACERAGTVRRLIYTASVVSASPFKDHQSGFNDFMDETSWTPLNDSFAYLFLDHYHKVSLLF*
• ORF Type: complete

Annotations of Ll_transcript_263303

• Blastp: Dihydroflavonol 4-reductase from Petunia with 40.61% of identity
• Blastx: Dihydroflavonol 4-reductase from Petunia with 40.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019418611.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;