Transcript | Ll_transcript_264451 |
---|---|
CDS coordinates | 438-1127 (+) |
Peptide sequence | MSSSKVKGLLRGLRYISQIFDNEKEEEIQIGLPTDVKHVAHIGWDGPSVTTPSWMNEFKSSPKFASAPLNLNGEIQNVGQDNPVKWVSEDSRRSSRQVNSRGLPELPRGSRRSSNNMTDSPTREKSNKPRQSRKSSKLKDSSDESNPNEQVMDTVQGDGSPARNLSDIPKKSRTKKSKENSCGGESSKLKSKGQSMECESPSGFVSKSMNNQRPLEENEQYQRGVSEIS* |
ORF Type | complete |
Blastp | CRIB domain-containing protein RIC7 from Arabidopsis with 54.41% of identity |
---|---|
Blastx | CRIB domain-containing protein RIC7 from Arabidopsis with 54.35% of identity |
Eggnog | regulation of growth(ENOG410Z01I) |
Kegg | Link to kegg annotations (AT4G28556) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019460404.1) |
Pfam | P21-Rho-binding domain (PF00786.27) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer