Protein coding transcript 169754

• Transcript: Ll_transcript_264451
• CDS coordinates: 438-1127 (+)
• Peptide sequence: MSSSKVKGLLRGLRYISQIFDNEKEEEIQIGLPTDVKHVAHIGWDGPSVTTPSWMNEFKSSPKFASAPLNLNGEIQNVGQDNPVKWVSEDSRRSSRQVNSRGLPELPRGSRRSSNNMTDSPTREKSNKPRQSRKSSKLKDSSDESNPNEQVMDTVQGDGSPARNLSDIPKKSRTKKSKENSCGGESSKLKSKGQSMECESPSGFVSKSMNNQRPLEENEQYQRGVSEIS*
• ORF Type: complete

Annotations of Ll_transcript_264451

• Blastp: CRIB domain-containing protein RIC7 from Arabidopsis with 54.41% of identity
• Blastx: CRIB domain-containing protein RIC7 from Arabidopsis with 54.35% of identity
• Eggnog: regulation of growth(ENOG410Z01I)
• Kegg: Link to kegg annotations (AT4G28556)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460404.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;