Protein coding transcript 169755

• Transcript: Ll_transcript_264455
• CDS coordinates: 388-1095 (+)
• Peptide sequence: MSSSTVKGILRGFRYISQIFDNEKEKEIEIGNPTDVKHVAHIGWDGPSVNTPSWMNEFKSSPEFASAPLNLNGEHQNIRQDRRQDDSVKWVSEDSKRSSRHVTSRGLSELPKGPRRSSNNMTDSPTNEKSNKSRQSRKTSKLKDSSDESNPSRQIMQMDTFLGDGSPARDLPDIPKKSRRKKSKDIPNSDESSKLRSKGQSMEPESPSEAIPKSRNKQRSLEENEPFERGVSEIS*
• ORF Type: complete

Annotations of Ll_transcript_264455

• Blastp: CRIB domain-containing protein RIC7 from Arabidopsis with 44.39% of identity
• Blastx: CRIB domain-containing protein RIC7 from Arabidopsis with 44.44% of identity
• Eggnog: regulation of growth(ENOG410Z01I)
• Kegg: Link to kegg annotations (AT4G28556)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433052.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;