Protein coding transcript 169758

• Transcript: Ll_transcript_264460
• CDS coordinates: 491-1153 (+)
• Peptide sequence: MSSKKVKGLLRGFKYISQIFDNEKEEEIQIGNPTDVKHVAHIGWDGPSVNTPSWMNEFKSSPGYASTPSDLDGELQHIEQDNSVKWVSEVSRRGSRHVNSKGPKIPTDSSIKEKSNKPKPSRKSSKLKDSLNESNPTQQFIQLDAFQGDESPANNVSDIPKKTRRKKLKDNSNFGESSKLRSKDQLMESESPSEFVSKPRNKQRFIEESGQYERGVSRIS*
• ORF Type: complete

Annotations of Ll_transcript_264460

• Blastp: CRIB domain-containing protein RIC6 from Arabidopsis with 51.15% of identity
• Blastx: CRIB domain-containing protein RIC7 from Arabidopsis with 57.52% of identity
• Eggnog: ROP-interactive CRIB motif-containing protein(ENOG410Z0SE)
• Kegg: Link to kegg annotations (AT2G20430)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427396.1)
• Pfam: P21-Rho-binding domain (PF00786.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;