Protein coding transcript 1699

• Transcript: Ll_transcript_297684
• CDS coordinates: 2-433 (+)
• Peptide sequence: QTTYENFRYRYDKKENPYTKGIMVNFKELSCSKIPSPLINFRSLVIEEEDVQDGSFTSDIENGFINPKHKFDMDMGTMYGKDGKRVPSILHDLDYNGIDDNLKKKAGSKEAGFEIFANADQDHKLTQWKSKTGINSPLDERKQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_297684

• Blastp: Probable protein S-acyltransferase 2 from Arabidopsis with 47.06% of identity
• Blastx: Probable protein S-acyltransferase 2 from Arabidopsis with 47.06% of identity
• Eggnog: Zinc finger, DHHC-type containing(COG5273)
• Kegg: Link to kegg annotations (AT2G40990)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429448.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;