Protein coding transcript 169950

• Transcript: Ll_transcript_263798
• CDS coordinates: 32-835 (+)
• Peptide sequence: MPYPNGYITSQLGNRLIYQELNYDRDELKRNFHSLFNSLTEEQYKIFQTIMQVVNTQQCRMFFLYGYGGTGKTHMWRTLTYALRSQKHIVLTVASSGIASLLLPGGRTTHSKFKIPVPTFDNSVCNIHHGTELAELLKQTKLIIWDEAPMSHKFCFEALDKSLCDIMGTTNGSILFGGKVVVFRGDFRQILPVIPRGYRSNIVHATINASYLWHQCKVLTLTKNMRLQNHDNESDTTQFSEWILKMGVENYLSLMMVVLKLISQMNF*
• ORF Type: complete

Annotations of Ll_transcript_263798

• Blastp: ATP-dependent DNA helicase PIF4 from Trypanosoma with 28.89% of identity
• Blastx: ATP-dependent DNA helicase PIF4 from Trypanosoma with 28.89% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (Tb11.01.6420)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413621.1)
• Pfam: PIF1-like helicase (PF05970.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;