Protein coding transcript 169953

• Transcript: Ll_transcript_263811
• CDS coordinates: 135-518 (+)
• Peptide sequence: MYLRLVVTKLANHVLETKIMSGKNIGNITYIPRLSMSPSQSSWPFTLIRRQFPIIVSYAMTINKSQGQSLESVGLYLPKPVFSHGQLYVAISRVQTKKGLKMLIHDEDGKPLRSTTNVVYKEVFQNL*
• ORF Type: complete

Annotations of Ll_transcript_263811

• Blastp: ATP-dependent DNA helicase pfh1 from Schizosaccharomyces with 49.09% of identity
• Blastx: ATP-dependent DNA helicase pfh1 from Schizosaccharomyces with 49.09% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPBC887.14c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019434840.1)
• Pfam: Helicase (PF02689.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;