Transcript | Ll_transcript_263446 |
---|---|
CDS coordinates | 101-907 (+) |
Peptide sequence | MCTTQYELCEEIGRGRFGTIYRCFDTTTNEIYACKIINKTLLTDSTDRECLQNEPKFMTLLSPHPNILQIYDVTQNDDVLTIVMELCQTLTLFDKIFQTTLSEPQSASIMLQLVSALNHCHQFGVAHRDLKPDNILFDSTETLKLGDFGSAEWFSEEKKMSGIVGTPYYVAPEVLIGREYDEKVDIWSCGVILYMMLVGIPPFYGDDAVQIFEAVVRGNLRFPSRLFRSVSSSAKDLLRKMICKDASRRFSAQQVLMHPWILSGGETS* |
ORF Type | complete |
Blastp | Phosphoenolpyruvate carboxylase kinase 1 from Arabidopsis with 58.21% of identity |
---|---|
Blastx | Phosphoenolpyruvate carboxylase kinase 1 from Arabidopsis with 58.21% of identity |
Eggnog | calcium-dependent protein kinase(ENOG410XRMJ) |
Kegg | Link to kegg annotations (AT1G08650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019439905.1) |
Pfam | Protein kinase domain (PF00069.24) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer