Protein coding transcript 170018

• Transcript: Ll_transcript_262461
• CDS coordinates: 123-824 (+)
• Peptide sequence: MQNPLTQTMNNPFFKVAVVGSGISGAVCASTLARNGVYVTLFDSARGPGGRMSQRREKTEDGKELHFDHGAPFFSVSKSELLCLVQEWQSRGLVAEWKEKFGSFDFRTLKFDNIYQEGSRKRYVGVPGMNSICKALCNESGVESKFGVSVGRVEWLDDAKLWSLIGVDGQNLGQFKGLVASDKNIVSPRIAEVTGRLPPLDLKLVPELSAKLHNLAARPCFAVMLAFAEPLSS*
• ORF Type: complete

Annotations of Ll_transcript_262461

• Blastp: Renalase from Pseudomonas with 31.19% of identity
• Blastx: Renalase from Pseudomonas with 30.69% of identity
• Eggnog: fad dependent oxidoreductase(COG3380)
• Kegg: Link to kegg annotations (PSPTO_1126)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443763.1)
• Pfam: NAD(P)-binding Rossmann-like domain (PF13450.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;