Transcript | Ll_transcript_262445 |
---|---|
CDS coordinates | 3507-3872 (+) |
Peptide sequence | MWCYLYSERWVLHSTAEYAADIIAQTGLKKPSEITLNKVAEQLFQEFQSTGLNISQPFYKRAHRWGSAFPAVSIAEDEKCLWDKSKRLAICGDFCVSPNVEGAIQSGLAAALRLKDSVSCL* |
ORF Type | complete |
Blastp | Renalase from Pseudomonas with 32.41% of identity |
---|---|
Blastx | - |
Eggnog | fad dependent oxidoreductase(COG3380) |
Kegg | Link to kegg annotations (PSPPH_1014) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019443763.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer